PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0332s00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 190aa    MW: 21209.9 Da    PI: 9.635
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0332s00070.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY29.81.9e-093770235
             YABBY  2 dvfssseqvCyvqCnfCntilavsvPstslfkvv 35
                      ++ s s+q+Cyv+CnfC+t+la ++ ++ + ++v
  Vang0332s00070.1 37 QHLSPSDQLCYVHCNFCDTVLAEEIRNAPSANMV 70
                      67899*****************988877766666 PP

2YABBY137.41.7e-427715392170
             YABBY  92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                       ++  v+s+   +   ee+p++p ++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  Vang0332s00070.1  77 PNDLVTST--MRGGPEETPKPPSANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 153
                       22333332..35667899***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.6E-64170IPR006780YABBY protein
PfamPF046901.1E-3889153IPR006780YABBY protein
SuperFamilySSF470952.75E-894147IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.5E-4102145IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
LISQSHQSNQ IIRKREKGIN KKRNNMSSSS TSFSPDQHLS PSDQLCYVHC NFCDTVLAEE  60
IRNAPSANMV MNQMPNPNDL VTSTMRGGPE ETPKPPSANR PPEKRQRVPS AYNRFIKDEI  120
QRIKAGNPDI SHREAFSAAA KNWAHFPHIH FGLMPDHQPV KKANVRQEAE DVLIKDGFFA  180
PANVGVSPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0983011e-158BT098301.1 Soybean clone JCVI-FLGm-12E18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515810.11e-105PREDICTED: axial regulator YABBY 1
SwissprotO221523e-57YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0L9VRS11e-105A0A0L9VRS1_PHAAN; Uncharacterized protein
STRINGGLYMA01G33370.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.16e-60YABBY family protein